Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP; R127A, R130S), Active Protein

Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP; R127A, R130S), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Thymic stromal lymphopoietin (TSLP; R127A, R130S) . Accession Number: A0A7N9CAT7; TSLP. Expression Region: 29-159aa (R127A, R130S) . Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 16.4kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP; R127A, R130S), Active Protein is a purified Active Recombinant Protein.

Accession Number

A0A7N9CAT7; TSLP

Expression Region

29-159aa (R127A, R130S)

Host

Mammalian Cells

Target

Thymic stromal lymphopoietin (TSLP; R127A, R130S)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLRT2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0787903 1.0 µg DNA

FLRT2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal ZBP1/DLM-1/DAI Antibody [Alexa Fluor 350]
NBP1-76854AF350 0.1 mL

Rabbit Polyclonal ZBP1/DLM-1/DAI Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Caskin1 Rat shRNA Lentiviral Particle (Locus ID 140722)
TL712449V 500 µL Each

Caskin1 Rat shRNA Lentiviral Particle (Locus ID 140722)

Sign In for Pricing
View Details
Mouse Monoclonal Twist-1 Antibody (927403) [Janelia Fluor 646]
FAB6230J 0.1 mL

Mouse Monoclonal Twist-1 Antibody (927403) [Janelia Fluor 646]

Sign In for Pricing
View Details
DTX1 Antibody
MBS8590869-01 0.1 mg

DTX1 Antibody

Sign In for Pricing
View Details
DTX1 Antibody
MBS8590869-02 0.1 mL (AF405L)

DTX1 Antibody

Sign In for Pricing
View Details