Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1) . Accession Number: Q4LDE5; SVEP1. Expression Region: 736-827aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 17.6kda. Target Synonyms: CCP module-containing protein 22; Polydom; Selectin-like osteoblast-derived protein; SEL-OB; Serologically defined breast cancer antigen NY-BR-38 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial is a purified Recombinant Protein.

Accession Number

Q4LDE5; SVEP1

Expression Region

736-827aa

Host

E. coli

Target

Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CCP module-containing protein 22; Polydom; Selectin-like osteoblast-derived protein; SEL-OB; Serologically defined breast cancer antigen NY-BR-38

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Androstenediol (AED) ELISA
KBH20093 1x 96 Well

GENLISA™ Human Androstenediol (AED) ELISA

Sign In for Pricing
View Details
Yadanzioside A
HY-N4257-01 1 mg

Yadanzioside A

Sign In for Pricing
View Details
Yadanzioside A
HY-N4257-02 5 mg

Yadanzioside A

Sign In for Pricing
View Details
Galk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7387706 1.0 µg DNA

Galk1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Gm4987 AAV siRNA Pooled Vector
58237164 1.0 µg

Gm4987 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human TFAM sgRNA gene knockout kit - Lentiviral human TFAM sgRNA gene knockout kit (100)
GTR15396673 1 Vial

Lentiviral human TFAM sgRNA gene knockout kit - Lentiviral human TFAM sgRNA gene knockout kit (100)

Sign In for Pricing
View Details