Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Forkhead box protein C1 (FOXC1)

Recombinant Human Forkhead box protein C1 (FOXC1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Forkhead box protein C1 (FOXC1) . Accession Number: Q12948; FOXC1. Expression Region: 1-553aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 62.8kda. Target Synonyms: Forkhead-related protein FKHL7; Forkhead-related transcription factor 3; FREAC-3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Forkhead box protein C1 (FOXC1) is a purified Recombinant Protein.

Accession Number

Q12948; FOXC1

Expression Region

1-553aa

Host

E. coli

Target

Forkhead box protein C1 (FOXC1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

62.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Forkhead-related protein FKHL7; Forkhead-related transcription factor 3; FREAC-3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament light polypeptide Rabbit Monoclonal Antibody
AMRe01596-01 50 µL

Neurofilament light polypeptide Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Neurofilament light polypeptide Rabbit Monoclonal Antibody
AMRe01596-02 100 µL

Neurofilament light polypeptide Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Neurofilament light polypeptide Rabbit Monoclonal Antibody
AMRe01596-03 200 µL

Neurofilament light polypeptide Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Ttc33 activation kit by CRISPRa
GA207374 1 Kit

Mouse Ttc33 activation kit by CRISPRa

Sign In for Pricing
View Details
0.25M TAPS buffer, pH 9.35
IBS-BT052 200 mL

0.25M TAPS buffer, pH 9.35

Sign In for Pricing
View Details
CD102 (CD102 Antigen, Intercellular Adhesion Molecule 2, ICAM 2, ICAM2, ICAM-2, Ly60) (Low Endotoxin)
C2445-59 500 µg

CD102 (CD102 Antigen, Intercellular Adhesion Molecule 2, ICAM 2, ICAM2, ICAM-2, Ly60) (Low Endotoxin)

Sign In for Pricing
View Details