Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Forkhead box protein C1 (FOXC1)

Recombinant Human Forkhead box protein C1 (FOXC1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Forkhead box protein C1 (FOXC1) . Accession Number: Q12948; FOXC1. Expression Region: 1-553aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 62.8kda. Target Synonyms: Forkhead-related protein FKHL7; Forkhead-related transcription factor 3; FREAC-3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Forkhead box protein C1 (FOXC1) is a purified Recombinant Protein.

Accession Number

Q12948; FOXC1

Expression Region

1-553aa

Host

E. coli

Target

Forkhead box protein C1 (FOXC1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

62.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Forkhead-related protein FKHL7; Forkhead-related transcription factor 3; FREAC-3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Incenp (NM_016692) Mouse Tagged ORF Clone
MR211041 10 µg

Incenp (NM_016692) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human H2BU1 shRNA (UAS) - Lentiviral human H2BU1 shRNA (UAS, GFP) (100)
GTR15112737 1 Vial

Lentiviral human H2BU1 shRNA (UAS) - Lentiviral human H2BU1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
GPR82 Double Nickase Plasmid (h)
sc-411978-NIC 20 µg

GPR82 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Human CMTM6 Nanobody Antibody
orb3155264-01 50 µg

Human CMTM6 Nanobody Antibody

Sign In for Pricing
View Details
Human CMTM6 Nanobody Antibody
orb3155264-02 100 µg

Human CMTM6 Nanobody Antibody

Sign In for Pricing
View Details
Human CMTM6 Nanobody Antibody
orb3155264-03 1 mg

Human CMTM6 Nanobody Antibody

Sign In for Pricing
View Details