Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor ligand superfamily member 9 (TNFSF9), Biotinylated. Accession Number: P41273; TNFSF9. Expression Region: 50-254aa. Tag Info: C-terminal hFc-Avi-tagged. Theoretical MW: 50.6kda. Target Synonyms: 4-1BB ligand; 4-1BBL Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated is a purified Recombinant Protein.

Accession Number

P41273; TNFSF9

Expression Region

50-254aa

Host

Mammalian Cells

Target

Tumor necrosis factor ligand superfamily member 9 (TNFSF9), Biotinylated

Conjugation

Unconjugated

Tag

C-Terminal hFc-Avi-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-1BB ligand; 4-1BBL

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnps1 (NM_001080127) Mouse Tagged ORF Clone
MR229134 10 µg

Rnps1 (NM_001080127) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRAF2, GST-Tag, Recombinant (TRAP, TRAP3, MGC:45012, TNF Receptor-Associated Factor 2) discontinued
501086 200 µg

TRAF2, GST-Tag, Recombinant (TRAP, TRAP3, MGC:45012, TNF Receptor-Associated Factor 2) discontinued

Sign In for Pricing
View Details
Viral Dengue Virus 2 NS1 MAb (Clone 969820)
MAB94392-SP 25 µg

Viral Dengue Virus 2 NS1 MAb (Clone 969820)

Sign In for Pricing
View Details
FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (PE)
MBS6446546-01 0.1 mL

FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (PE)

Sign In for Pricing
View Details
FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (PE)
MBS6446546-02 5x 0.1 mL

FDFT1 (SS, SQS, DGPT, ERG9, Farnesyl-diphosphate Farnesyltransferase) (PE)

Sign In for Pricing
View Details
Mouse Fascin 2 (FSCN2) Antibody Pair Kit (with Standard)
MBS2103124-01 5x 96 Tests

Mouse Fascin 2 (FSCN2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details