Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs is a purified MP-VLP Transmembrane Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: B-lymphocyte antigen CD20 (Ms4a1) -VLPs. Accession Number: P19437; Ms4a1. Expression Region: 1-291aa. Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 33.7kda. Target Synonyms: B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) -VLPs is a purified MP-VLP Transmembrane Protein.

Accession Number

P19437; Ms4a1

Expression Region

1-291aa

Host

Mammalian Cells

Target

B-lymphocyte antigen CD20 (Ms4a1) -VLPs

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged (This tag can be tested only under denaturing conditions)

Field of Research

Others

Endotoxin

Not Tested

Purity

The purity information is not available for VLPs proteins

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20

Species

Mouse (Mus musculus)

Protein Name

MP-VLP Transmembrane Protein

AA Sequence

MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)
MBS1151853-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)
MBS1151853-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)
MBS1151853-03 0.1 mg (E-Coli)

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)
MBS1151853-04 0.1 mg (Yeast)

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)
MBS1151853-05 0.02 mg (Baculovirus)

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)
MBS1151853-06 0.02 mg (Mammalian-Cell)

Recombinant Bacillus subtilis 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase (iolJ)

Sign In for Pricing
View Details