Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 (IL6), Biotinylated

Recombinant Human Interleukin-6 (IL6), Biotinylated is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Interleukin-6 (IL6), Biotinylated. Accession Number: P05231; IL6. Expression Region: 30-212aa. Tag Info: N-terminal Avi-tagged. Theoretical MW: 24.3kda. Target Synonyms: IL-6; B-cell stimulatory factor 2; BSF-2; CTL differentiation factor; CDF; Hybridoma growth factor; Interferon beta-2; IFN-beta-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-6 (IL6), Biotinylated is a purified Recombinant Protein.

Accession Number

P05231; IL6

Expression Region

30-212aa

Host

Mammalian Cells

Target

Interleukin-6 (IL6), Biotinylated

Conjugation

Unconjugated

Tag

N-Terminal Avi-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-6; B-cell stimulatory factor 2; BSF-2; CTL differentiation factor; CDF; Hybridoma growth factor; Interferon beta-2; IFN-beta-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor® 647 Succinimidyl Ester
WJY0-LS19 Each

iFluor® 647 Succinimidyl Ester

Sign In for Pricing
View Details
XKR7 3'UTR Luciferase Stable Cell Line
TU028585 1.0 mL

XKR7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat IL-1β (Interleukin 1 Beta) ELISA Kit
EKF57939 96 Tests

Rat IL-1β (Interleukin 1 Beta) ELISA Kit

Sign In for Pricing
View Details
STING Recombinant Rabbit mAb (SDT-R150)
S0B0084-01 1 mL

STING Recombinant Rabbit mAb (SDT-R150)

Sign In for Pricing
View Details
STING Recombinant Rabbit mAb (SDT-R150)
S0B0084-02 25 µL

STING Recombinant Rabbit mAb (SDT-R150)

Sign In for Pricing
View Details
STING Recombinant Rabbit mAb (SDT-R150)
S0B0084-03 100 µL

STING Recombinant Rabbit mAb (SDT-R150)

Sign In for Pricing
View Details