Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial, Biotinylated

Recombinant Human CD276 antigen (CD276), partial, Biotinylated is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD276 antigen (CD276), Biotinylated. Accession Number: Q5ZPR3; CD276. Expression Region: 29-245aa. Tag Info: C-terminal hFc-Avi-tagged. Theoretical MW: 52.8kda. Target Synonyms: 4Ig-B7-H3; B7 homolog 3; B7-H3; Costimulatory molecule; CD antigen CD276 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human CD276 antigen (CD276), partial, Biotinylated is a purified Recombinant Protein.

Accession Number

Q5ZPR3; CD276

Expression Region

29-245aa

Host

Mammalian Cells

Target

CD276 antigen (CD276), Biotinylated

Conjugation

Unconjugated

Tag

C-Terminal hFc-Avi-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4Ig-B7-H3; B7 homolog 3; B7-H3; Costimulatory molecule; CD antigen CD276

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sex Determining Region Y Box Protein 11 (SOX11) Peptide
abx616857 100 µg

Sex Determining Region Y Box Protein 11 (SOX11) Peptide

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF594 conjugate, 0.1mg/mL
BNC941482-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lentiviral mouse Zfp148 shRNA (UAS) - Lentiviral mouse Zfp148 shRNA (UAS, iRFP) (100)
GTR15256323 1 Vial

Lentiviral mouse Zfp148 shRNA (UAS) - Lentiviral mouse Zfp148 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit
BSKR62826-01 48 Tests

Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit
BSKR62826-02 96 Tests

Rat Platelet/Endothelial Cell Adhesion Molecule (PECAM1) ELISA Kit

Sign In for Pricing
View Details
LOC153364 Protein Vector (Human) (pPM-C-HA)
PV023991 500 ng

LOC153364 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details