Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial, Biotinylated

Recombinant Human CD276 antigen (CD276), partial, Biotinylated is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD276 antigen (CD276), Biotinylated. Accession Number: Q5ZPR3; CD276. Expression Region: 29-245aa. Tag Info: C-terminal hFc-Avi-tagged. Theoretical MW: 52.8kda. Target Synonyms: 4Ig-B7-H3; B7 homolog 3; B7-H3; Costimulatory molecule; CD antigen CD276 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human CD276 antigen (CD276), partial, Biotinylated is a purified Recombinant Protein.

Accession Number

Q5ZPR3; CD276

Expression Region

29-245aa

Host

Mammalian Cells

Target

CD276 antigen (CD276), Biotinylated

Conjugation

Unconjugated

Tag

C-Terminal hFc-Avi-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4Ig-B7-H3; B7 homolog 3; B7-H3; Costimulatory molecule; CD antigen CD276

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 5 Rabbit mAb
59005 50 µL

Caspase 5 Rabbit mAb

Sign In for Pricing
View Details
OB Cadherin (CAD11, CAD11_HUMAN, Cadherin 11, Cadherin 11 Type 2, Cadherin 11 Type 2 OB cadherin (osteoblast), Cadherin-11, Cdh11, CDHOB, OB, OB-cadherin, OBcadherin, OSF-4, OSF4, Osteoblast cadherin)
254200 100 µL

OB Cadherin (CAD11, CAD11_HUMAN, Cadherin 11, Cadherin 11 Type 2, Cadherin 11 Type 2 OB cadherin (osteoblast), Cadherin-11, Cdh11, CDHOB, OB, OB-cadherin, OBcadherin, OSF-4, OSF4, Osteoblast cadherin)

Sign In for Pricing
View Details
Human Protein NPAT (NPAT) ELISA Kit
abx535640 96 Tests

Human Protein NPAT (NPAT) ELISA Kit

Sign In for Pricing
View Details
Human Nptx1 (Neuronal Pentraxin 1) ELISA Kit
FY-EH3638 96 Well

Human Nptx1 (Neuronal Pentraxin 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal PD-1 Antibody (PDCD1/7255R) [Janelia Fluor 669]
NBP3-20956JF669 0.1 mL

Rabbit Monoclonal PD-1 Antibody (PDCD1/7255R) [Janelia Fluor 669]

Sign In for Pricing
View Details
Tmem173 (NM_028261) Mouse Recombinant Protein
E45M42352M5 20 µg

Tmem173 (NM_028261) Mouse Recombinant Protein

Sign In for Pricing
View Details