Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5)

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ragulator complex protein LAMTOR5 (LAMTOR5) . Accession Number: O43504; LAMTOR5. Expression Region: 1-91aa. Tag Info: N-terminal 6xHis-KSI-tagged. Theoretical MW: 24.9kda. Target Synonyms: Hepatitis B virus X-interacting protein; HBV X-interacting protein; HBX-interacting protein; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5) is a purified Recombinant Protein.

Accession Number

O43504; LAMTOR5

Expression Region

1-91aa

Host

E. coli

Target

Ragulator complex protein LAMTOR5 (LAMTOR5)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-KSI-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatitis B virus X-interacting protein; HBV X-interacting protein; HBX-interacting protein; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parkin (H-8) Alexa Fluor® 790
sc-136989 AF790 200 µg/mL

Parkin (H-8) Alexa Fluor® 790

Sign In for Pricing
View Details
Endorphin, alpha (1-16) (Human, Rat, Mouse)
022-02 500 µg

Endorphin, alpha (1-16) (Human, Rat, Mouse)

Sign In for Pricing
View Details
[KO Validated] SHMT2 polyclonal antibody
BS6257-01 50 µL

[KO Validated] SHMT2 polyclonal antibody

Sign In for Pricing
View Details
[KO Validated] SHMT2 polyclonal antibody
BS6257-02 100 µL

[KO Validated] SHMT2 polyclonal antibody

Sign In for Pricing
View Details
Cdc25B Rabbit Polyclonal Antibody (Cy3)
orb2621272 100 µg

Cdc25B Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
IL1 beta/IL1B Rabbit Polyclonal Antibody (Carrier-free)
orb3083390 100 µg

IL1 beta/IL1B Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details