Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5)

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Ragulator complex protein LAMTOR5 (LAMTOR5) . Accession Number: O43504; LAMTOR5. Expression Region: 1-91aa. Tag Info: N-terminal 6xHis-KSI-tagged. Theoretical MW: 24.9kda. Target Synonyms: Hepatitis B virus X-interacting protein; HBV X-interacting protein; HBX-interacting protein; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5) is a purified Recombinant Protein.

Accession Number

O43504; LAMTOR5

Expression Region

1-91aa

Host

E. coli

Target

Ragulator complex protein LAMTOR5 (LAMTOR5)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-KSI-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatitis B virus X-interacting protein; HBV X-interacting protein; HBX-interacting protein; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-M.tuberculosis Rv3849 Polyclonal Antibody
TRI-AB-061 0.1mg

Anti-M.tuberculosis Rv3849 Polyclonal Antibody

Sign In for Pricing
View Details
BMP-2 discontinued
386476 200 µL

BMP-2 discontinued

Sign In for Pricing
View Details
Anti-ADAM2  (4A2)
YF-MA13146 100 ug

Anti-ADAM2 (4A2)

Sign In for Pricing
View Details
CD155 Rabbit mAb
E2R90087 100 µL

CD155 Rabbit mAb

Sign In for Pricing
View Details
PE/XFD700 Anti-human CD164 Antibody *67D2*
116401O0-AAT 25 Tests

PE/XFD700 Anti-human CD164 Antibody *67D2*

Sign In for Pricing
View Details
GASP2 Polyclonal Antibody
JOT-AP09403-01 20 µL

GASP2 Polyclonal Antibody

Sign In for Pricing
View Details