Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2)

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Basic leucine zipper and W2 domain-containing protein 2 (BZW2) . Accession Number: Q9Y6E2; BZW2. Expression Region: 1-419aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 55.1kda. Target Synonyms: Basic leucine zipper and W2 domain-containing protein 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Basic leucine zipper and W2 domain-containing protein 2 (BZW2) is a purified Recombinant Protein.

Accession Number

Q9Y6E2; BZW2

Expression Region

1-419aa

Host

E. coli

Target

Basic leucine zipper and W2 domain-containing protein 2 (BZW2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Basic leucine zipper and W2 domain-containing protein 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 2T35 (OR2T35) ELISA Kit
abx536489 96 Tests

Human Olfactory receptor 2T35 (OR2T35) ELISA Kit

Sign In for Pricing
View Details
WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)
MBS6145170-01 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)

Sign In for Pricing
View Details
WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)
MBS6145170-02 5x 0.1 mL

WDR41 (WD Repeat-containing Protein 41, MSTP048) (Biotin)

Sign In for Pricing
View Details
Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)
MBS7010214-01 0.02 mg

Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)

Sign In for Pricing
View Details
Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)
MBS7010214-02 0.1 mg

Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)

Sign In for Pricing
View Details
Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)
MBS7010214-03 5x 0.1 mg

Recombinant Oryza sativa ATP synthase subunit a, chloroplastic (atpI)

Sign In for Pricing
View Details