Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3)

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Lys-63-specific deubiquitinase BRCC36 (Brcc3) . Accession Number: P46737; Brcc3. Expression Region: 2-291aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 40.7kda. Target Synonyms: BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 3; BRCA1/BRCA2-containing complex subunit 36; BRISC complex subunit BRCC36 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Lys-63-specific deubiquitinase BRCC36 (Brcc3) is a purified Recombinant Protein.

Accession Number

P46737; Brcc3

Expression Region

2-291aa

Host

E. coli

Target

Lys-63-specific deubiquitinase BRCC36 (Brcc3)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein of Isoform 1

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 3; BRCA1/BRCA2-containing complex subunit 36; BRISC complex subunit BRCC36

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMEELSSLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTOP (ACD) Human qPCR Primer Pair (NM_022914)
HP233160 200 Reactions

PTOP (ACD) Human qPCR Primer Pair (NM_022914)

Sign In for Pricing
View Details
Uncoated Rat EGF (Epidermal Growth Factor) ELISA Kit
E-UNEL-R0009-01 5x 96 Tests

Uncoated Rat EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat EGF (Epidermal Growth Factor) ELISA Kit
E-UNEL-R0009-02 15x 96 Tests

Uncoated Rat EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
PIK3C2G Human Gene Knockout Kit (CRISPR)
KN417086 1 Kit

PIK3C2G Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
OC-108-01 50 μL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
OC-108-02 100 µL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details