Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stabilin-1 (Stab1), partial

Recombinant Mouse Stabilin-1 (Stab1), partial is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Stabilin-1 (Stab1) . Accession Number: Q8R4Y4; Stab1. Expression Region: 1604-1703aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 16.6kda. Target Synonyms: Fasciclin; EGF-like; laminin-type EGF-like and link domain-containing scavenger receptor 1; FEEL-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Stabilin-1 (Stab1), partial is a purified Recombinant Protein.

Accession Number

Q8R4Y4; Stab1

Expression Region

1604-1703aa

Host

E. coli

Target

Stabilin-1 (Stab1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fasciclin; EGF-like; laminin-type EGF-like and link domain-containing scavenger receptor 1; FEEL-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

LEYKELKGDGPFTVFVPHADLISNMSQDELARIRAHRQLVFRYHVVGCRKLWSQEMLDQGYITTLSGHTLRVSEREGSIYLNDFARVVSSDLEVVNGVLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)
MBS1282230-01 0.02 mg (E-Coli)

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)

Sign In for Pricing
View Details
Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)
MBS1282230-02 0.02 mg (Yeast)

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)

Sign In for Pricing
View Details
Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)
MBS1282230-03 0.1 mg (E-Coli)

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)

Sign In for Pricing
View Details
Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)
MBS1282230-04 0.1 mg (Yeast)

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)

Sign In for Pricing
View Details
Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)
MBS1282230-05 0.02 mg (Baculovirus)

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)

Sign In for Pricing
View Details
Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)
MBS1282230-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse TBC1 domain family member 12 (Tbc1d12)

Sign In for Pricing
View Details