Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial

Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Spectrin beta chain, non-erythrocytic 1 (Sptbn1) . Accession Number: Q62261; Sptbn1. Expression Region: 2199-2304aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 19.8kda. Target Synonyms: Beta-II spectrin; Embryonic liver fodrin; Fodrin beta chain Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial is a purified Recombinant Protein.

Accession Number

Q62261; Sptbn1

Expression Region

2199-2304aa

Host

E. coli

Target

Spectrin beta chain, non-erythrocytic 1 (Sptbn1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-II spectrin; Embryonic liver fodrin; Fodrin beta chain

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malachite green monoclonal antibody
MB9348 50ul

Malachite green monoclonal antibody

Sign In for Pricing
View Details
SEC22A siRNA (Rat)
CRR3107-01 15 nmol

SEC22A siRNA (Rat)

Sign In for Pricing
View Details
SEC22A siRNA (Rat)
CRR3107-02 30 nmol

SEC22A siRNA (Rat)

Sign In for Pricing
View Details
Olr390 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7141708 1.0 µg DNA

Olr390 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Cytomegalovirus, Strain AD 169 (CMV)
MBS633429-01 0.2 mg

Cytomegalovirus, Strain AD 169 (CMV)

Sign In for Pricing
View Details
Cytomegalovirus, Strain AD 169 (CMV)
MBS633429-02 5x 0.2 mg

Cytomegalovirus, Strain AD 169 (CMV)

Sign In for Pricing
View Details