Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Multiple epidermal growth factor-like domains protein 6 (MEGF6) . Accession Number: O75095; MEGF6. Expression Region: 165-370aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 26.4kda. Target Synonyms: Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial is a purified Recombinant Protein.

Accession Number

O75095; MEGF6

Expression Region

165-370aa

Host

E. coli

Target

Multiple epidermal growth factor-like domains protein 6 (MEGF6)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYELDTDQRTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NLR Pyrin Domain Containing Proteins 3
GTR10382532 96 Well

Human NLR Pyrin Domain Containing Proteins 3

Sign In for Pricing
View Details
anti-ENO3
YF-PA11571 100 ug

anti-ENO3

Sign In for Pricing
View Details
Mouse Monoclonal Cystatin S Antibody (OTI2H10) [Alexa Fluor 488]
NBP2-70481AF488 0.1 mL

Mouse Monoclonal Cystatin S Antibody (OTI2H10) [Alexa Fluor 488]

Sign In for Pricing
View Details
Mouse Monoclonal PTGFR Antibody (1014602) [DyLight 350]
FAB10294D 0.1 mL

Mouse Monoclonal PTGFR Antibody (1014602) [DyLight 350]

Sign In for Pricing
View Details
Lgals7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6839105 3x 1.0 µg

Lgals7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
BP-1 Human (Recombinant)
22061154-1 2 µg

BP-1 Human (Recombinant)

Sign In for Pricing
View Details