Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Multiple epidermal growth factor-like domains protein 6 (MEGF6) . Accession Number: O75095; MEGF6. Expression Region: 165-370aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 26.4kda. Target Synonyms: Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial is a purified Recombinant Protein.

Accession Number

O75095; MEGF6

Expression Region

165-370aa

Host

E. coli

Target

Multiple epidermal growth factor-like domains protein 6 (MEGF6)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYELDTDQRTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STEAP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45715111 3x 1.0 µg

STEAP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Efcab10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3172006 1.0 µg DNA

Efcab10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (MaxLight 405)
MBS6311328-01 0.1 mL

ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (MaxLight 405)

Sign In for Pricing
View Details
ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (MaxLight 405)
MBS6311328-02 5x 0.1 mL

ITIH1, ID (ITIH1, IGHEP1, Inter-alpha-trypsin inhibitor heavy chain H1, Inter-alpha-trypsin inhibitor complex component III, Serum-derived hyaluronan-associated protein) (MaxLight 405)

Sign In for Pricing
View Details
KHSRP Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61958R-BF488-TR 20 µL

KHSRP Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Mouse TM2 domain-containing protein 2 (TM2D2) ELISA Kit
abx550243 96 Tests

Mouse TM2 domain-containing protein 2 (TM2D2) ELISA Kit

Sign In for Pricing
View Details