Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Multiple epidermal growth factor-like domains protein 6 (MEGF6) . Accession Number: O75095; MEGF6. Expression Region: 165-370aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 26.4kda. Target Synonyms: Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Multiple epidermal growth factor-like domains protein 6 (MEGF6), partial is a purified Recombinant Protein.

Accession Number

O75095; MEGF6

Expression Region

165-370aa

Host

E. coli

Target

Multiple epidermal growth factor-like domains protein 6 (MEGF6)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Multiple EGF-like domains protein 6; Epidermal growth factor-like protein 3; EGF-like protein 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYELDTDQRTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endo G Polyclonal Antibody, RBITC Conjugated
bs-2800R-RBITC 100 µL

Endo G Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 405)
MBS6486060-01 0.1 mL

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 405)

Sign In for Pricing
View Details
CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 405)
MBS6486060-02 5x 0.1 mL

CCL2, CT (C-C motif Chemokine 2, Small-inducible Cytokine A2, Monocyte Chemoattractant Protein 1, Monocyte Chemotactic Protein 1, MCP-1, Monocyte Chemotactic And Activating Factor, MCAF, Monocyte Secretory Protein JE, HC11, SCYA2, MCP1) (MaxLight 405)

Sign In for Pricing
View Details
VPREB Rabbit Polyclonal Antibody
MBS9517796-01 0.05 mL

VPREB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VPREB Rabbit Polyclonal Antibody
MBS9517796-02 0.1 mL

VPREB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VPREB Rabbit Polyclonal Antibody
MBS9517796-03 5x 0.1 mL

VPREB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details