Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Y-box-binding protein 2 (YBX2)

Recombinant Human Y-box-binding protein 2 (YBX2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Y-box-binding protein 2 (YBX2) . Accession Number: Q9Y2T7; YBX2. Expression Region: 1-364aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 45.5kda. Target Synonyms: Contrin; DNA-binding protein C; Dbpc; Germ cell-specific Y-box-binding protein; MSY2 homolog Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Y-box-binding protein 2 (YBX2) is a purified Recombinant Protein.

Accession Number

Q9Y2T7; YBX2

Expression Region

1-364aa

Host

E. coli

Target

Y-box-binding protein 2 (YBX2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Contrin; DNA-binding protein C; Dbpc; Germ cell-specific Y-box-binding protein; MSY2 homolog

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone:16G2]
E45M13736 100 µg

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody [Clone:16G2]

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032651-01 0.02 mg

Recombinant Salmonella enteritidis PT4 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032651-02 0.1 mg

Recombinant Salmonella enteritidis PT4 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032651-03 5x 0.1 mg

Recombinant Salmonella enteritidis PT4 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
CXCL11 (IP9, H174, IP-9, b-R1, I-TAC, SCYB11, SCYB9B, Chemokine C-X-C-Motif Ligand 11) (MaxLight 405)
MBS6445991-01 0.1 mL

CXCL11 (IP9, H174, IP-9, b-R1, I-TAC, SCYB11, SCYB9B, Chemokine C-X-C-Motif Ligand 11) (MaxLight 405)

Sign In for Pricing
View Details
CXCL11 (IP9, H174, IP-9, b-R1, I-TAC, SCYB11, SCYB9B, Chemokine C-X-C-Motif Ligand 11) (MaxLight 405)
MBS6445991-02 5x 0.1 mL

CXCL11 (IP9, H174, IP-9, b-R1, I-TAC, SCYB11, SCYB9B, Chemokine C-X-C-Motif Ligand 11) (MaxLight 405)

Sign In for Pricing
View Details