Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Androgen receptor (AR), partial

Recombinant Human Androgen receptor (AR), partial is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Androgen receptor (AR) . Accession Number: P10275; AR. Expression Region: 559-671aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 18.6kda. Target Synonyms: Dihydrotestosterone receptor; Nuclear receptor subfamily 3 group C member 4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Androgen receptor (AR), partial is a purified Recombinant Protein.

Accession Number

P10275; AR

Expression Region

559-671aa

Host

E. coli

Target

Androgen receptor (AR)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Dihydrotestosterone receptor; Nuclear receptor subfamily 3 group C member 4

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Myotubularin-related protein 12,Mtmr12 ELISA KIT
ELI-20635r 96 Tests

Rat Myotubularin-related protein 12,Mtmr12 ELISA KIT

Sign In for Pricing
View Details
Giantin HDR Plasmid (h)
sc-418145-HDR 20 µg

Giantin HDR Plasmid (h)

Sign In for Pricing
View Details
Dffb Rabbit Polyclonal Antibody
TA305970 100 µg

Dffb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Coiled-coil domain-containing protein 93 (CCDC93) ELISA Kit
abx505494 96 Tests

Mouse Coiled-coil domain-containing protein 93 (CCDC93) ELISA Kit

Sign In for Pricing
View Details
Selumetinib Nitroso Impurity 19
RM-S052119-01 10 mg

Selumetinib Nitroso Impurity 19

Sign In for Pricing
View Details
Selumetinib Nitroso Impurity 19
RM-S052119-02 100 mg

Selumetinib Nitroso Impurity 19

Sign In for Pricing
View Details