Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3; R235A, E246A), partial

Recombinant Human NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3; R235A, E246A), partial is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3; R235A, E246A) . Accession Number: Q9NTG7; SIRT3. Expression Region: 118-289aa&302-399aa (R235A, E246A) . Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 30.7kda. Target Synonyms: hSIRT3; Regulatory protein SIR2 homolog 3; SIR2-like protein 3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3; R235A, E246A), partial is a purified Recombinant Protein.

Accession Number

Q9NTG7; SIRT3

Expression Region

118-289aa&302-399aa (R235A, E246A)

Host

E. coli

Target

NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3; R235A, E246A)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HSIRT3; Regulatory protein SIR2 homolog 3; SIR2-like protein 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLEAVSGIPASKLVAAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iris Scissor, Straight
43200012-2 5 Each

Iris Scissor, Straight

Sign In for Pricing
View Details
Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 750)
MBS6295961-01 0.1 mL

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 750)

Sign In for Pricing
View Details
Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 750)
MBS6295961-02 5x 0.1 mL

Epha1, ID (Epha1, Esk, Ephrin type-A receptor 1, Embryonic stem cell kinase, Tyrosine-protein kinase receptor ESK) (MaxLight 750)

Sign In for Pricing
View Details
UBASH3A Mouse Monoclonal Antibody [Clone ID: LBI4H1]
AMM18867VCF 100 µg

UBASH3A Mouse Monoclonal Antibody [Clone ID: LBI4H1]

Sign In for Pricing
View Details
Diisopropyl Phthalate
RG-A262246-01 10 mg

Diisopropyl Phthalate

Sign In for Pricing
View Details
Diisopropyl Phthalate
RG-A262246-02 25 mg

Diisopropyl Phthalate

Sign In for Pricing
View Details