Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Protein UL20 (UL20), partial

Recombinant Human herpesvirus 2 Protein UL20 (UL20), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) . Target Name: herpesvirus 2 Protein UL20 (UL20) . Accession Number: P89443; UL20. Expression Region: 1-63aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 14kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 2 Protein UL20 (UL20), partial is a purified Recombinant Protein.

Accession Number

P89443; UL20

Expression Region

1-63aa

Host

E. coli

Target

Herpesvirus 2 Protein UL20 (UL20)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Protein Name

Recombinant Protein

AA Sequence

MTMRDDVPLLDRELVDEAACGGEDGELPLDEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC2 Recombinant Rabbit Monoclonal Antibody [JE58-79]
HA720030 100 µL

ARPC2 Recombinant Rabbit Monoclonal Antibody [JE58-79]

Sign In for Pricing
View Details
Streptavidin High Binding Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MGSTDF-SB75/100/W 10x 96 Well Plates

Streptavidin High Binding Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
Recombinant Ryanodine Receptor Monoclonal Antibody
AN301983L-01 50 µL

Recombinant Ryanodine Receptor Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Ryanodine Receptor Monoclonal Antibody
AN301983L-02 100 µL

Recombinant Ryanodine Receptor Monoclonal Antibody

Sign In for Pricing
View Details
SORBS1 (NM_001034955) Human Over-expression Lysate
LC422115 20 µg

SORBS1 (NM_001034955) Human Over-expression Lysate

Sign In for Pricing
View Details
TNF-alpha (Tumor Necrosis Factor alpha), CF568 conjugate, 0.1mg/mL
BNC681674-500 1x 500 µL

TNF-alpha (Tumor Necrosis Factor alpha), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details