Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Wnt-3a (Wnt3a), partial

Recombinant Mouse Protein Wnt-3a (Wnt3a), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Protein Wnt-3a (Wnt3a) . Accession Number: P27467; Wnt3a. Expression Region: 130-250aa. Tag Info: N-terminal GST-tagged. Theoretical MW: 40.9kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Protein Wnt-3a (Wnt3a), partial is a purified Recombinant Protein.

Accession Number

P27467; Wnt3a

Expression Region

130-250aa

Host

E. coli

Target

Protein Wnt-3a (Wnt3a)

Conjugation

Unconjugated

Tag

N-Terminal GST-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Glial fibrillary acidic protein (GFAP) ELISA Kit
MBS2802630-01 48 Tests

Fish Glial fibrillary acidic protein (GFAP) ELISA Kit

Sign In for Pricing
View Details
Fish Glial fibrillary acidic protein (GFAP) ELISA Kit
MBS2802630-02 96 Tests

Fish Glial fibrillary acidic protein (GFAP) ELISA Kit

Sign In for Pricing
View Details
Fish Glial fibrillary acidic protein (GFAP) ELISA Kit
MBS2802630-03 5x 96 Tests

Fish Glial fibrillary acidic protein (GFAP) ELISA Kit

Sign In for Pricing
View Details
Fish Glial fibrillary acidic protein (GFAP) ELISA Kit
MBS2802630-04 10x 96 Tests

Fish Glial fibrillary acidic protein (GFAP) ELISA Kit

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, CD227, episialin) (MaxLight 490)
MBS6245303-01 0.1 mL

Mucin 1 (MUC1 Glycoprotein, CD227, episialin) (MaxLight 490)

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, CD227, episialin) (MaxLight 490)
MBS6245303-02 5x 0.1 mL

Mucin 1 (MUC1 Glycoprotein, CD227, episialin) (MaxLight 490)

Sign In for Pricing
View Details