Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Coxiella burnetii (strain RSA 493 / Nine Mile phase I) . Target Name: Hypothetical membrane spanning protein (CBU_1863) . Accession Number: Q83AM0; CBU_1863. Expression Region: 255-414aa. Tag Info: N-terminal 6xHis-GST-tagged. Theoretical MW: 49.9kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Coxiella burnetii Hypothetical membrane spanning protein (CBU_1863), partial is a purified Recombinant Protein.

Accession Number

Q83AM0; CBU_1863

Expression Region

255-414aa

Host

E. coli

Target

Hypothetical membrane spanning protein (CBU_1863)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-GST-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

49.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

Protein Name

Recombinant Protein

AA Sequence

PGAVGYLLNPLLGRCRPFPELEQFRKDLEKNYLNPAVQRINEKTPERFIEVFYDTIKENPNKWTGYDIYKNTIEKAFQVGGLIAVQHFFGLFQQLAAEGWGKISPQLENNCGLNSISAATTAFFYYLLVLKLPPTFRKSLEQIWILGVHNSRTLPAKIIK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERC4 Knockout 786-O Polyclonal Cells
ARG25247 1 Million

HERC4 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Mouse TJP1 (Tight junction protein ZO-1) ELISA Kit
RE1884M-01 48 Tests

Mouse TJP1 (Tight junction protein ZO-1) ELISA Kit

Sign In for Pricing
View Details
Mouse TJP1 (Tight junction protein ZO-1) ELISA Kit
RE1884M-02 96 Tests

Mouse TJP1 (Tight junction protein ZO-1) ELISA Kit

Sign In for Pricing
View Details
Nono sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7309207 1.0 µg DNA

Nono sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MCM4, CT (MCM4, CDC21, DNA replication licensing factor MCM4, CDC21 homolog, P1-CDC21) (Biotin)
MBS6319696-01 0.2 mL

MCM4, CT (MCM4, CDC21, DNA replication licensing factor MCM4, CDC21 homolog, P1-CDC21) (Biotin)

Sign In for Pricing
View Details
MCM4, CT (MCM4, CDC21, DNA replication licensing factor MCM4, CDC21 homolog, P1-CDC21) (Biotin)
MBS6319696-02 5x 0.2 mL

MCM4, CT (MCM4, CDC21, DNA replication licensing factor MCM4, CDC21 homolog, P1-CDC21) (Biotin)

Sign In for Pricing
View Details