Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Delta-like protein 3 (DLL3) . Accession Number: Q9NYJ7; DLL3. Expression Region: 429-492aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 8.1kda. Target Synonyms: Delta-like protein 3; Drosophila Delta homolog 3; Delta3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NYJ7; DLL3

Expression Region

429-492aa

Host

Mammalian Cells

Target

Delta-like protein 3 (DLL3)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Developmental Biology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Delta-like protein 3; Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Marveld3 (NM_028584) Mouse Tagged ORF Clone
MR225336 10 µg

Marveld3 (NM_028584) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
NSUN2, ID (NSUN2, SAKI, TRM4, tRNA (cytosine (34) -C (5) ) -methyltransferase, Myc-induced SUN domain-containing protein, NOL1/NOP2/Sun domain family member 2, Substrate of AIM1/Aurora kinase B, tRNA (cytosine-5-) -methyltransferase, tRNA methyltransferase 4 homolog) (MaxLight 550) discontinued
039167-ML550 100 µL

NSUN2, ID (NSUN2, SAKI, TRM4, tRNA (cytosine (34) -C (5) ) -methyltransferase, Myc-induced SUN domain-containing protein, NOL1/NOP2/Sun domain family member 2, Substrate of AIM1/Aurora kinase B, tRNA (cytosine-5-) -methyltransferase, tRNA methyltransferase 4 homolog) (MaxLight 550) discontinued

Sign In for Pricing
View Details
[D-Arg2, Lys4]-Dermorphin, amide Peptide
abx265944-01 5 mg

[D-Arg2, Lys4]-Dermorphin, amide Peptide

Sign In for Pricing
View Details
[D-Arg2, Lys4]-Dermorphin, amide Peptide
abx265944-02 10 mg

[D-Arg2, Lys4]-Dermorphin, amide Peptide

Sign In for Pricing
View Details
[D-Arg2, Lys4]-Dermorphin, amide Peptide
abx265944-03 25 mg

[D-Arg2, Lys4]-Dermorphin, amide Peptide

Sign In for Pricing
View Details
Brain Heart Infus 500gm
211059 1 Each

Brain Heart Infus 500gm

Sign In for Pricing
View Details