Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Delta-like protein 3 (DLL3) . Accession Number: Q9NYJ7; DLL3. Expression Region: 429-492aa. Tag Info: C-terminal mFc-tagged. Theoretical MW: 36.0kda. Target Synonyms: Delta-like protein 3; Drosophila Delta homolog 3; Delta3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NYJ7; DLL3

Expression Region

429-492aa

Host

Mammalian Cells

Target

Delta-like protein 3 (DLL3)

Conjugation

Unconjugated

Tag

C-Terminal mFc-Tagged

Field of Research

Developmental Biology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Delta-like protein 3; Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU4-4P 3'UTR Luciferase Stable Cell Line
TU020152 1.0 mL

RNU4-4P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HCLS1 CytoSection
TS400329P5 25 Slides

HCLS1 CytoSection

Sign In for Pricing
View Details
Human Olfactory receptor 13J1 (OR13J1) ELISA Kit
abx536457 96 Tests

Human Olfactory receptor 13J1 (OR13J1) ELISA Kit

Sign In for Pricing
View Details
Human High Mobility Group Nucleosome Binding Domain Protein 1 (HMGN1) ELISA Kit
RDR-HMGN1-Hu-48Tests 48 Tests

Human High Mobility Group Nucleosome Binding Domain Protein 1 (HMGN1) ELISA Kit

Sign In for Pricing
View Details
Anti-Catenin, gamma Antibody Clone CTNG/1664, Unconjugated-100ug
3728-MSM4-P1 100ug

Anti-Catenin, gamma Antibody Clone CTNG/1664, Unconjugated-100ug

Sign In for Pricing
View Details
AKT Kinase Inhibitor 5mg
A11285-5 5 mg

AKT Kinase Inhibitor 5mg

Sign In for Pricing
View Details