Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Delta-like protein 3 (DLL3) . Accession Number: Q9NYJ7; DLL3. Expression Region: 429-492aa. Tag Info: C-terminal mFc-tagged. Theoretical MW: 36.0kda. Target Synonyms: Delta-like protein 3; Drosophila Delta homolog 3; Delta3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NYJ7; DLL3

Expression Region

429-492aa

Host

Mammalian Cells

Target

Delta-like protein 3 (DLL3)

Conjugation

Unconjugated

Tag

C-Terminal mFc-Tagged

Field of Research

Developmental Biology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Delta-like protein 3; Drosophila Delta homolog 3; Delta3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-ethoxy-3- (morpholin-4-ylsulfonyl) aniline
sc-349427A 5 g

4-ethoxy-3- (morpholin-4-ylsulfonyl) aniline

Sign In for Pricing
View Details
Human Fibrinogen Degradation Product, FDP ELISA Kit
CK-bio-11460-01 48 Tests

Human Fibrinogen Degradation Product, FDP ELISA Kit

Sign In for Pricing
View Details
Human Fibrinogen Degradation Product, FDP ELISA Kit
CK-bio-11460-02 96 Tests

Human Fibrinogen Degradation Product, FDP ELISA Kit

Sign In for Pricing
View Details
Human Fibrinogen Degradation Product, FDP ELISA Kit
CK-bio-11460-03 5x 96 Tests

Human Fibrinogen Degradation Product, FDP ELISA Kit

Sign In for Pricing
View Details
Human Fibrinogen Degradation Product, FDP ELISA Kit
CK-bio-11460-04 10x 96 Tests

Human Fibrinogen Degradation Product, FDP ELISA Kit

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum PFE0595w Protein (aa 1-119)
VAng-Wyb6698-50gEcoli 50 µg (E. coli)

Recombinant Plasmodium Falciparum PFE0595w Protein (aa 1-119)

Sign In for Pricing
View Details