Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aldehyde dehydrogenase 1A1 (Aldh1a1)

Recombinant Mouse Aldehyde dehydrogenase 1A1 (Aldh1a1) is a purified Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aldehyde dehydrogenase 1A1 (Aldh1a1) . Accession Number: P24549; Aldh1a1. Expression Region: 2-501aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 58.4kda. Target Synonyms: 3-deoxyglucosone dehydrogenase; ALDH-E1; ALHDII; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase; cytosolic; Retinal dehydrogenase 1; RALDH 1; RalDH1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Aldehyde dehydrogenase 1A1 (Aldh1a1) is a purified Recombinant Protein.

Accession Number

P24549; Aldh1a1

Expression Region

2-501aa

Host

E. coli

Target

Aldehyde dehydrogenase 1A1 (Aldh1a1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>95% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

58.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

3-deoxyglucosone dehydrogenase; ALDH-E1; ALHDII; Aldehyde dehydrogenase family 1 member A1; Aldehyde dehydrogenase; cytosolic; Retinal dehydrogenase 1; RALDH 1; RalDH1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfr907 activation kit by CRISPRa
GA215719 1 Kit

Mouse Olfr907 activation kit by CRISPRa

Sign In for Pricing
View Details
Hsa-miR-570-5p miRNA Mimic
CMH1878-01 5 nmol

Hsa-miR-570-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-570-5p miRNA Mimic
CMH1878-02 10 nmol

Hsa-miR-570-5p miRNA Mimic

Sign In for Pricing
View Details
Lentiviral mouse Mettl26 shRNA (UAS) - Lentiviral mouse Mettl26 shRNA (UAS, RFP) plasmid
GTR15237973 1 Vial

Lentiviral mouse Mettl26 shRNA (UAS) - Lentiviral mouse Mettl26 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mouse Gga2 ELISA KIT
ELI-48658m 96 Tests

Mouse Gga2 ELISA KIT

Sign In for Pricing
View Details
MGluR1a Recombinant Rabbit mAb
orb2326307-01 25 µL

MGluR1a Recombinant Rabbit mAb

Sign In for Pricing
View Details