Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Decapping and exoribonuclease protein (dxo)

Recombinant Xenopus laevis Decapping and exoribonuclease protein (dxo) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Xenopus laevis (African clawed frog) . Target Name: Decapping and exoribonuclease protein (dxo) . Accession Number: Q5HZT0; dxo. Expression Region: 1-401aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 50.3kda. Target Synonyms: DXO; 5'-3' exoribonuclease DXO; Dom-3 homolog Z; NAD-capped RNA hydrolase DXO; DeNADding enzyme DXO Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Xenopus laevis Decapping and exoribonuclease protein (dxo) is a purified Recombinant Protein.

Accession Number

Q5HZT0; dxo

Expression Region

1-401aa

Host

E. coli

Target

Decapping and exoribonuclease protein (dxo)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DXO; 5'-3' exoribonuclease DXO; Dom-3 homolog Z; NAD-capped RNA hydrolase DXO; DeNADding enzyme DXO

Species

Xenopus laevis (African clawed frog)

Protein Name

Recombinant Protein

AA Sequence

MEGNKSMQREKIDRPMKRGPEQNSLSPPLAKCPFMSCSSLKTLHSLYQGSFPFYRLPSEVGHFSLDENRQYHQDNRKLRYYSPPVGIREKGSPGWNVMDGYESHYVRRNEDEKEGLLHILTWLEKNRGVLGAHVEGGSKRPIDRDFVTWRGHLTKILCTPYETQEGWLLAVTLFKGTFYISEQETEAAQKKRKERSLEQERLMYSGYKFESYICADSPDRQPSQSAVVNTNEGFCSVLLARLTSHSLLISGEVDCTDPSAKKSIPPTCYIELKSSAQIRNPHQQRSFNRYKLLKWWCQSFLLGIPIIVAGFRSPEGRIVSLETFKTSDIPHLVRGERNSWDPAVCMNFCNKFLSHIKSVVTRDDPRLVYLFAWEPGCDVTFTVHTDPEYTILPSWYVNSVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal ORF73/HHV8 Antibody (HHV8/3633R) [DyLight 405]
NBP3-08397V 100 µL

Rabbit Monoclonal ORF73/HHV8 Antibody (HHV8/3633R) [DyLight 405]

Sign In for Pricing
View Details
SEM4C Polyclonal Antibody
BT-AP14108-01 20 µL

SEM4C Polyclonal Antibody

Sign In for Pricing
View Details
SEM4C Polyclonal Antibody
BT-AP14108-02 50 µL

SEM4C Polyclonal Antibody

Sign In for Pricing
View Details
SEM4C Polyclonal Antibody
BT-AP14108-03 100 µL

SEM4C Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-ITGB4 (Tyr1494) Polyclonal Antibody, APC Conjugated
bs-5455R-APC 100 µL

Phospho-ITGB4 (Tyr1494) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Hamster Neuroglobin ELISA Kit
MBS032707-01 48 Well

Hamster Neuroglobin ELISA Kit

Sign In for Pricing
View Details