Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Candidapepsin-2 (SAP2; L273V)

Recombinant Candida albicans Candidapepsin-2 (SAP2; L273V) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (Yeast) . Target Name: Candidapepsin-2 (SAP2; L273V) . Accession Number: P0CS83; SAP2. Expression Region: 57-398aa (L273V) . Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 42.4kda. Target Synonyms: ACP 2; Aspartate protease 2; Secreted aspartic protease 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Candida albicans Candidapepsin-2 (SAP2; L273V) is a purified Recombinant Protein.

Accession Number

P0CS83; SAP2

Expression Region

57-398aa (L273V)

Host

E. coli

Target

Candidapepsin-2 (SAP2; L273V)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ACP 2; Aspartate protease 2; Secreted aspartic protease 2

Species

Candida albicans (Yeast)

Protein Name

Recombinant Protein

AA Sequence

QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLVDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASSISALT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F1 Human Gene Knockout Kit (CRISPR)
KN208247 1 Kit

E2F1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stau1 (NM_053436) Rat Tagged ORF Clone Lentiviral Particle
RR200249L4V 200 µL

Stau1 (NM_053436) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Polr2h sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6612707 1.0 µg DNA

Polr2h sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human IRGC, GST-tagged
IRGC-158H 25 µg

Recombinant Human IRGC, GST-tagged

Sign In for Pricing
View Details
CD8 alpha (APC) discontinued
214740 25 Tests

CD8 alpha (APC) discontinued

Sign In for Pricing
View Details
OKRC00670-96W - LILRB4/CD85k/ILT-3 ELISA Kit (Human)
OKRC00670-96W 96 Well

OKRC00670-96W - LILRB4/CD85k/ILT-3 ELISA Kit (Human)

Sign In for Pricing
View Details