Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Candidapepsin-2 (SAP2; L273V)

Recombinant Candida albicans Candidapepsin-2 (SAP2; L273V) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (Yeast) . Target Name: Candidapepsin-2 (SAP2; L273V) . Accession Number: P0CS83; SAP2. Expression Region: 57-398aa (L273V) . Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 42.4kda. Target Synonyms: ACP 2; Aspartate protease 2; Secreted aspartic protease 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Candida albicans Candidapepsin-2 (SAP2; L273V) is a purified Recombinant Protein.

Accession Number

P0CS83; SAP2

Expression Region

57-398aa (L273V)

Host

E. coli

Target

Candidapepsin-2 (SAP2; L273V)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ACP 2; Aspartate protease 2; Secreted aspartic protease 2

Species

Candida albicans (Yeast)

Protein Name

Recombinant Protein

AA Sequence

QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLVDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASSISALT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF737, NT (ZNF737, ZNF102, Zinc finger protein 737, Zinc finger protein 102) (Azide free) (HRP)
MBS6367629-01 0.2 mL

ZNF737, NT (ZNF737, ZNF102, Zinc finger protein 737, Zinc finger protein 102) (Azide free) (HRP)

Sign In for Pricing
View Details
ZNF737, NT (ZNF737, ZNF102, Zinc finger protein 737, Zinc finger protein 102) (Azide free) (HRP)
MBS6367629-02 5x 0.2 mL

ZNF737, NT (ZNF737, ZNF102, Zinc finger protein 737, Zinc finger protein 102) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) NADA Polyclonal Antibody
MBS7174770 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) NADA Polyclonal Antibody

Sign In for Pricing
View Details
Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-EL-H6210-01 24 Tests

Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details
Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-EL-H6210-02 48 Tests

Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details
Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-EL-H6210-03 96 Tests

Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details