Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor-binding protein 3 receptor (TMEM219) . Accession Number: Q86XT9; TMEM219. Expression Region: 39-204aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 23.7kda. Target Synonyms: IGFBP-3R; Transmembrane protein 219 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial is a purified Recombinant Protein.

Accession Number

Q86XT9; TMEM219

Expression Region

39-204aa

Host

E. coli

Target

Insulin-like growth factor-binding protein 3 receptor (TMEM219)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IGFBP-3R; Transmembrane protein 219

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DQB2 Human Over-expression Lysate
orb1376133 20 µg

HLA-DQB2 Human Over-expression Lysate

Sign In for Pricing
View Details
RAB7, CT (Ras-related Protein Rab-7a, RAB7A) (PE)
MBS6496363-01 0.2 mL

RAB7, CT (Ras-related Protein Rab-7a, RAB7A) (PE)

Sign In for Pricing
View Details
RAB7, CT (Ras-related Protein Rab-7a, RAB7A) (PE)
MBS6496363-02 5x 0.2 mL

RAB7, CT (Ras-related Protein Rab-7a, RAB7A) (PE)

Sign In for Pricing
View Details
GAGE7 Rabbit Polyclonal Antibody (APC-Cy7)
orb2397537 100 µL

GAGE7 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
LIAS Rabbit pAb, BF700 conjugated
orb2874001 100 µL

LIAS Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mitochondrial import inner membrane translocase subunit TIM44 (TIMM44) Human ELISA Kit
F0274 96 Tests

Mitochondrial import inner membrane translocase subunit TIM44 (TIMM44) Human ELISA Kit

Sign In for Pricing
View Details