Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Interferon gamma (IFNG)

Recombinant Mesocricetus auratus Interferon gamma (IFNG) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mesocricetus auratus (Golden hamster) . Target Name: Interferon gamma (IFNG) . Accession Number: O35497; IFNG. Expression Region: 24-174aa. Tag Info: N-terminal 6xHis-tagged and C-terminal Strep II-tagged. Theoretical MW: 19.3kda. Target Synonyms: IFN-gamma Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mesocricetus auratus Interferon gamma (IFNG) is a purified Recombinant Protein.

Accession Number

O35497; IFNG

Expression Region

24-174aa

Host

E. coli

Target

Interferon gamma (IFNG)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged and C-Terminal Strep II-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IFN-gamma

Species

Mesocricetus auratus (Golden hamster)

Protein Name

Recombinant Protein

AA Sequence

QGTLIEEIENLKKYFNSSSLDVVNGGDLVFNILTNWQKAGDTKIIESQIVSFYFKLFEALKDNQAIQRSIDTIKADLFANFFNSSMEKLNDFVKLTKIPVNDLQVQRKAVNELISVMPHLSRKLSLRKRKRSRCCFGGGNRPNKNILASNI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (FITC)
249812-FITC 100 µL

PCAF (K (Lysine) Acetyltransferase 2B, CAF, P, P/CAF, PCAF) (FITC)

Sign In for Pricing
View Details
ELISA kit for Rat ?-EPR (Beta-Endorphin Receptor)
E-EL-R0104 96 Tests

ELISA kit for Rat ?-EPR (Beta-Endorphin Receptor)

Sign In for Pricing
View Details
RNF207, CT (RNF207, C1orf188, RING finger protein 207)
041132 200 µL

RNF207, CT (RNF207, C1orf188, RING finger protein 207)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Angiopoietin Like Protein 8 (ANGPTL8)
MBS2085762-01 0.1 mL

APC-Linked Polyclonal Antibody to Angiopoietin Like Protein 8 (ANGPTL8)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Angiopoietin Like Protein 8 (ANGPTL8)
MBS2085762-02 0.2 mL

APC-Linked Polyclonal Antibody to Angiopoietin Like Protein 8 (ANGPTL8)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Angiopoietin Like Protein 8 (ANGPTL8)
MBS2085762-03 0.5 mL

APC-Linked Polyclonal Antibody to Angiopoietin Like Protein 8 (ANGPTL8)

Sign In for Pricing
View Details