Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor-binding protein 7 (IGFBP7) . Accession Number: Q16270; IGFBP7. Expression Region: 27-282aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.3kda. Target Synonyms: IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor; TAF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) is a purified Recombinant Protein.

Accession Number

Q16270; IGFBP7

Expression Region

27-282aa

Host

E. coli

Target

Insulin-like growth factor-binding protein 7 (IGFBP7)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor; TAF

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYW5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48903111 3x 1.0 µg

TYW5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human Integrator complex subunit 4, INTS4 ELISA Kit
MBS9333062-01 48 Well

Human Integrator complex subunit 4, INTS4 ELISA Kit

Sign In for Pricing
View Details
Human Integrator complex subunit 4, INTS4 ELISA Kit
MBS9333062-02 96 Well

Human Integrator complex subunit 4, INTS4 ELISA Kit

Sign In for Pricing
View Details
Human Integrator complex subunit 4, INTS4 ELISA Kit
MBS9333062-03 5x 96 Well

Human Integrator complex subunit 4, INTS4 ELISA Kit

Sign In for Pricing
View Details
Human Integrator complex subunit 4, INTS4 ELISA Kit
MBS9333062-04 10x 96 Well

Human Integrator complex subunit 4, INTS4 ELISA Kit

Sign In for Pricing
View Details
PTP4A3 Protein Vector (Mouse) (pPM-C-HA)
PV220812 500 ng

PTP4A3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details