Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor-binding protein 7 (IGFBP7) . Accession Number: Q16270; IGFBP7. Expression Region: 27-282aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.3kda. Target Synonyms: IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor; TAF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) is a purified Recombinant Protein.

Accession Number

Q16270; IGFBP7

Expression Region

27-282aa

Host

E. coli

Target

Insulin-like growth factor-binding protein 7 (IGFBP7)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor; TAF

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gβ 1 siRNA (h)
sc-41762 10 µM

Gβ 1 siRNA (h)

Sign In for Pricing
View Details
101Bio Denaturing Protein Solubilization Reagent
P5W9 10 mL

101Bio Denaturing Protein Solubilization Reagent

Sign In for Pricing
View Details
FAM151B Antibody, Biotin conjugated
A58155-100UG 100 µg

FAM151B Antibody, Biotin conjugated

Sign In for Pricing
View Details
FRG2A Lentiviral Activation Particles (h)
sc-417267-LAC 200 µL

FRG2A Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Tryptone Bile Agar
B2016548 250 g

Tryptone Bile Agar

Sign In for Pricing
View Details
Cas9 Expressing Monkey Primary Cardiac Fibroblasts
NHFF-1123-HX29 Each

Cas9 Expressing Monkey Primary Cardiac Fibroblasts

Sign In for Pricing
View Details