Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7)

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor-binding protein 7 (IGFBP7) . Accession Number: Q16270; IGFBP7. Expression Region: 27-282aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 33.3kda. Target Synonyms: IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor; TAF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) is a purified Recombinant Protein.

Accession Number

Q16270; IGFBP7

Expression Region

27-282aa

Host

E. coli

Target

Insulin-like growth factor-binding protein 7 (IGFBP7)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor; TAF

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inducible nitric oxide Synthase (INOS) Rat ELISA Kit
E2559 96 Tests

Inducible nitric oxide Synthase (INOS) Rat ELISA Kit

Sign In for Pricing
View Details
Polypeptide N-acetylgalactosaminyltransferase 1 (GALNT1) Human ELISA Kit
G0036 96 Tests

Polypeptide N-acetylgalactosaminyltransferase 1 (GALNT1) Human ELISA Kit

Sign In for Pricing
View Details
PPP1R11 Protein Vector (Rat) (pPB-N-His)
PV295595 500 ng

PPP1R11 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
PRICKLE4 (NM_013397) Human Tagged ORF Clone Lentiviral Particle
RC211641L4V 200 µL

PRICKLE4 (NM_013397) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MFluor™ Violet 500 Anti-human CD54 Antibody *R6-5-D6*
10540101-AAT 500 Tests

MFluor™ Violet 500 Anti-human CD54 Antibody *R6-5-D6*

Sign In for Pricing
View Details
Adenosine-5'-diphosphate trisodium salt
MBS5751542 Inquire

Adenosine-5'-diphosphate trisodium salt

Sign In for Pricing
View Details