Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH)

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium intracellulare. Target Name: Lipoprotein lpqH (lpqH) . Accession Number: P31502; lpqH. Expression Region: 22-162aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 19.6kda. Target Synonyms: 19 kDa lipoprotein antigen; 22 kDa lipoprotein antigen; Mi22 antigen; Putative transporter LpqH Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH) is a purified Recombinant Protein.

Accession Number

P31502; lpqH

Expression Region

22-162aa

Host

E. coli

Target

Lipoprotein lpqH (lpqH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

19 kDa lipoprotein antigen; 22 kDa lipoprotein antigen; Mi22 antigen; Putative transporter LpqH

Species

Mycobacterium intracellulare

Protein Name

Recombinant Protein

AA Sequence

CSGGNKSGTSASSSANSSGTTRRLAPGAAGTKVTIDGKDQNVSGSVVCTNAGGTINIAIGGAATGIAAVLSDGNPPQVKSVGLGNVNGVTLGYTSGTGQGNATASKDGNSYKISGTATGVDMANPMQPVNKPFEINVTCNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gastrointestinalcancer Marker-CA199 (CA199) ELISA Kit
YP-W20991-01 48 Tests

Mouse Gastrointestinalcancer Marker-CA199 (CA199) ELISA Kit

Sign In for Pricing
View Details
Mouse Gastrointestinalcancer Marker-CA199 (CA199) ELISA Kit
YP-W20991-02 96 Tests

Mouse Gastrointestinalcancer Marker-CA199 (CA199) ELISA Kit

Sign In for Pricing
View Details
RSAD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV694360 1.0 µg DNA

RSAD2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)
MBS2026971-01 0.1 mL

Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)
MBS2026971-02 0.2 mL

Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)

Sign In for Pricing
View Details
Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)
MBS2026971-03 0.5 mL

Polyclonal Antibody to Fucosidase Alpha L1, Tissue (FUCa1)

Sign In for Pricing
View Details