Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH)

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium intracellulare. Target Name: Lipoprotein lpqH (lpqH) . Accession Number: P31502; lpqH. Expression Region: 22-162aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 19.6kda. Target Synonyms: 19 kDa lipoprotein antigen; 22 kDa lipoprotein antigen; Mi22 antigen; Putative transporter LpqH Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH) is a purified Recombinant Protein.

Accession Number

P31502; lpqH

Expression Region

22-162aa

Host

E. coli

Target

Lipoprotein lpqH (lpqH)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

19 kDa lipoprotein antigen; 22 kDa lipoprotein antigen; Mi22 antigen; Putative transporter LpqH

Species

Mycobacterium intracellulare

Protein Name

Recombinant Protein

AA Sequence

CSGGNKSGTSASSSANSSGTTRRLAPGAAGTKVTIDGKDQNVSGSVVCTNAGGTINIAIGGAATGIAAVLSDGNPPQVKSVGLGNVNGVTLGYTSGTGQGNATASKDGNSYKISGTATGVDMANPMQPVNKPFEINVTCNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNCA Human
OM306211-01 20 µg

SNCA Human

Sign In for Pricing
View Details
SNCA Human
OM306211-02 100 µg

SNCA Human

Sign In for Pricing
View Details
SNCA Human
OM306211-03 1 mg

SNCA Human

Sign In for Pricing
View Details
Rabbit Polyclonal c-Myc Antibody [Allophycocyanin]
NB600-336APC 0.1 mL

Rabbit Polyclonal c-Myc Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Rat anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit
MBS7242393-01 48 Well

Rat anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit

Sign In for Pricing
View Details
Rat anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit
MBS7242393-02 96 Well

Rat anti-deoxyribonuclease B antibody (anti-DNase B Ab) ELISA Kit

Sign In for Pricing
View Details