Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B), Active Protein

Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B), Active Protein is a purified Active Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: zymogen granule protein 16 homolog B (ZG16B) . Accession Number: G7Q0A1; ZG16B. Expression Region: 23-169aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 17.6kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Macaca fascicularis zymogen granule protein 16 homolog B (ZG16B), Active Protein is a purified Active Recombinant Protein.

Accession Number

G7Q0A1; ZG16B

Expression Region

23-169aa

Host

Mammalian Cells

Target

Zymogen granule protein 16 homolog B (ZG16B)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>90% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Active Recombinant Protein

AA Sequence

GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propargylamine, Hydrochloride
TRC-P762525-2.5G 2.5 g

Propargylamine, Hydrochloride

Sign In for Pricing
View Details
Rabbit Anti-Human RUVBL1 pAb
PA14298-01 50 μL

Rabbit Anti-Human RUVBL1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human RUVBL1 pAb
PA14298-02 100 μL

Rabbit Anti-Human RUVBL1 pAb

Sign In for Pricing
View Details
Lentiviral mouse Ftl1 shRNA (UAS) - Lentiviral mouseFtl1 shRNA (UAS, GFP) (25)
GTR15227372 1 Vial

Lentiviral mouse Ftl1 shRNA (UAS) - Lentiviral mouseFtl1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Spnb4 Protein Vector (Mouse) (pPM-C-HA)
45356024 500 ng

Spnb4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SLC25A52 (HRP)
576703-01 50 µg

SLC25A52 (HRP)

Sign In for Pricing
View Details