Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-6 (CLDN6) -VLPs, Fluorescent , Active Protein

Recombinant Human Claudin-6 (CLDN6) -VLPs, Fluorescent , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Claudin-6 (CLDN6) -VLPs, Fluorescent. Accession Number: P56747; CLDN6. Expression Region: 1-220aa. Tag Info: C-terminal EGFP-tagged. Theoretical MW: 50.5kda. Target Synonyms: UNQ757; PRO1488 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Claudin-6 (CLDN6) -VLPs, Fluorescent , Active Protein is a purified MP-VLP Transmembrane Protein; Active Protein.

Accession Number

P56747; CLDN6

Expression Region

1-220aa

Host

Mammalian Cells

Target

Claudin-6 (CLDN6) -VLPs, Fluorescent

Conjugation

Unconjugated

Tag

C-Terminal EGFP-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

The purity information is not available for VLPs proteins

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

UNQ757; PRO1488

Species

Human (Homo sapiens)

Protein Name

MP-VLP Transmembrane Protein; Active Protein

AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP4P2 (NM_018710) Human Over-expression Lysate
LC402708 20 µg

PIP4P2 (NM_018710) Human Over-expression Lysate

Sign In for Pricing
View Details
2,6-Dichloronicotinyl Chloride
TRC-D435520-5G 5 g

2,6-Dichloronicotinyl Chloride

Sign In for Pricing
View Details
PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]
TA801483AM 100 µL

PI 3 Kinase catalytic subunit alpha (PIK3CA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]

Sign In for Pricing
View Details
Recombinant Rat PDGFRa/CD140a Protein (Fc Tag)
PKSR030168 100 µg

Recombinant Rat PDGFRa/CD140a Protein (Fc Tag)

Sign In for Pricing
View Details
Human Neuroserpin (NSP) ELISA Kit
RDR-NSP-Hu-01 96 Tests

Human Neuroserpin (NSP) ELISA Kit

Sign In for Pricing
View Details
Human Neuroserpin (NSP) ELISA Kit
RDR-NSP-Hu-02 48 Tests

Human Neuroserpin (NSP) ELISA Kit

Sign In for Pricing
View Details