Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein GOLM2 (GOLM2), partial

Recombinant Human Protein GOLM2 (GOLM2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Protein GOLM2 (GOLM2) . Accession Number: Q6P4E1; GOLM2. Expression Region: 36-436aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 53.1kda. Target Synonyms: Cancer susceptibility candidate gene 4 protein; CASC4; Golgi membrane protein 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Protein GOLM2 (GOLM2), partial is a purified Recombinant Protein.

Accession Number

Q6P4E1; GOLM2

Expression Region

36-436aa

Host

E. coli

Target

Protein GOLM2 (GOLM2)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cancer susceptibility candidate gene 4 protein; CASC4; Golgi membrane protein 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDTHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNEEPSSNHIPHGKEQIKRGGDAGMPGIEENDLAKVDDLPPALRKPPISVSQHESHQAISHLPTGQPLSPNMPPDSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDGNVGEYEADKQAELAYNEEEDGDGGEEDVQDDEERELQMDPADYGKQHFNDVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2Z CRISPRa sgRNA lentivector (set of three targets)(Mouse)
49014124 3x 1.0µg DNA

UBE2Z CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
STAMBPL1 Antibody - C-terminal region (ARP73285_P050)
ARP73285_P050 100 µL

STAMBPL1 Antibody - C-terminal region (ARP73285_P050)

Sign In for Pricing
View Details
Rat Pasteurella haemolytica Positive Control
MBS412068-01 1 mL

Rat Pasteurella haemolytica Positive Control

Sign In for Pricing
View Details
Rat Pasteurella haemolytica Positive Control
MBS412068-02 5x 1 mL

Rat Pasteurella haemolytica Positive Control

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae tRNA pseudouridine synthase D (truD)
MBS1374926-01 0.02 mg (E-Coli)

Recombinant Pseudomonas syringae pv. syringae tRNA pseudouridine synthase D (truD)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. syringae tRNA pseudouridine synthase D (truD)
MBS1374926-02 0.02 mg (Yeast)

Recombinant Pseudomonas syringae pv. syringae tRNA pseudouridine synthase D (truD)

Sign In for Pricing
View Details