Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Phospholipase A2 group XV (Pla2g15)

Recombinant Rat Phospholipase A2 group XV (Pla2g15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Phospholipase A2 group XV (Pla2g15) . Accession Number: Q675A5; Pla2g15. Expression Region: 34-413aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 51.0kda. Target Synonyms: 1-O-acylceramide synthase; ACS; LCAT-like lysophospholipase; LLPL; Lysophospholipase 3; Lysosomal phospholipase A and acyltransferase; Lysosomal phospholipase A2; LPLA2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Phospholipase A2 group XV (Pla2g15) is a purified Recombinant Protein.

Accession Number

Q675A5; Pla2g15

Expression Region

34-413aa

Host

E. coli

Target

Phospholipase A2 group XV (Pla2g15)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1-O-acylceramide synthase; ACS; LCAT-like lysophospholipase; LLPL; Lysophospholipase 3; Lysosomal phospholipase A and acyltransferase; Lysosomal phospholipase A2; LPLA2

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OATP2 (SLCO1B1) (NM_006446) Human Over-expression Lysate
LY401938 100 µg

OATP2 (SLCO1B1) (NM_006446) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PRRG3 activation kit by CRISPRa
GA112339 1 Kit

Human PRRG3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS705807 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
PKM Goat Polyclonal Antibody
TA396718S 25 µL

PKM Goat Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) (NM_000941) Human Over-expression Lysate
LC424436 20 µg

Cytochrome P450 Reductase (POR) (NM_000941) Human Over-expression Lysate

Sign In for Pricing
View Details
ITIH4 (70k, Cleaved-Arg661) Antibody
8L0122-AAT 50 µg

ITIH4 (70k, Cleaved-Arg661) Antibody

Sign In for Pricing
View Details