Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Phospholipase A2 group XV (Pla2g15)

Recombinant Rat Phospholipase A2 group XV (Pla2g15) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Phospholipase A2 group XV (Pla2g15) . Accession Number: Q675A5; Pla2g15. Expression Region: 34-413aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 51.0kda. Target Synonyms: 1-O-acylceramide synthase; ACS; LCAT-like lysophospholipase; LLPL; Lysophospholipase 3; Lysosomal phospholipase A and acyltransferase; Lysosomal phospholipase A2; LPLA2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Phospholipase A2 group XV (Pla2g15) is a purified Recombinant Protein.

Accession Number

Q675A5; Pla2g15

Expression Region

34-413aa

Host

E. coli

Target

Phospholipase A2 group XV (Pla2g15)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

1-O-acylceramide synthase; ACS; LCAT-like lysophospholipase; LLPL; Lysophospholipase 3; Lysosomal phospholipase A and acyltransferase; Lysosomal phospholipase A2; LPLA2

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMUR2 Rabbit Polyclonal Antibody
TA379188 100 µL

NMUR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R2B (NM_001127381) Human Over-expression Lysate
LY426765 100 µg

PPP2R2B (NM_001127381) Human Over-expression Lysate

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL
BNC040287-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (h-CALD), CF568 conjugate, 0.1mg/mL
BNC680819-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (h-CALD), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HBM (NM_001003938) Human Recombinant Protein
TP307833M 100 µg

HBM (NM_001003938) Human Recombinant Protein

Sign In for Pricing
View Details