Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 19 (TRBV19)

Recombinant Human T cell receptor beta variable 19 (TRBV19) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: T cell receptor beta variable 19 (TRBV19) . Accession Number: A0A075B6N1; TRBV19. Expression Region: 22-114aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 16.7kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human T cell receptor beta variable 19 (TRBV19) is a purified Recombinant Protein.

Accession Number

A0A075B6N1; TRBV19

Expression Region

22-114aa

Host

E. coli

Target

T cell receptor beta variable 19 (TRBV19)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUFT1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
48838064 1.0 µg DNA

TUFT1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Calretinin (H-5) Alexa Fluor® 488
sc-365956 AF488 200 µg/mL

Calretinin (H-5) Alexa Fluor® 488

Sign In for Pricing
View Details
Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)
MBS1066072-01 0.02 mg (E-Coli)

Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)

Sign In for Pricing
View Details
Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)
MBS1066072-02 0.02 mg (Yeast)

Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)

Sign In for Pricing
View Details
Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)
MBS1066072-03 0.1 mg (E-Coli)

Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)

Sign In for Pricing
View Details
Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)
MBS1066072-04 0.1 mg (Yeast)

Recombinant Brucella canis Anhydro-N-acetylmuramic acid kinase (anmK)

Sign In for Pricing
View Details