Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Heat shock protein 60, mitochondrial (HSP60), partial

Recombinant Saccharomyces cerevisiae Heat shock protein 60, mitochondrial (HSP60), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) . Target Name: Heat shock protein 60, mitochondrial (HSP60) . Accession Number: P19882; HSP60. Expression Region: 156-435aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 31.2kda. Target Synonyms: CPN60; P66; Stimulator factor I 66 kDa component Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Saccharomyces cerevisiae Heat shock protein 60, mitochondrial (HSP60), partial is a purified Recombinant Protein.

Accession Number

P19882; HSP60

Expression Region

156-435aa

Host

E. coli

Target

Heat shock protein 60, mitochondrial (HSP60)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CPN60; P66; Stimulator factor I 66 kDa component

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Protein Name

Recombinant Protein

AA Sequence

KKEITTSEEIAQVATISANGDSHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPLLLLSEKKISSIQDILPALEISNQSRRPLLIIAEDVDGEALAACILNKLRGQVKVCAVKAPGFGDNRKNTIGDIAVLTGGTVFTEELDLKPEQCTIENLGSCDSITVTKEDTVILNGSGPKEAIQERIEQIKGSIDITTTNSYEKEKLQERLAKLSGGVAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRKCG sgRNA gene knockout kit - Lentiviral human PRKCG sgRNA gene knockout kit (25)
GTR15372066 1 Vial

Lentiviral human PRKCG sgRNA gene knockout kit - Lentiviral human PRKCG sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
RABAC1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV671598 1.0 µg DNA

RABAC1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SLC38A2 Recombinant Protein (Human)
RP029080 100 µg

SLC38A2 Recombinant Protein (Human)

Sign In for Pricing
View Details
CNN2P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV721501 1.0 µg DNA

CNN2P8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GENLISA Canine Dopamine Receptor D2 (DRD2) ELISA
KLN0549 1x 96 Well

GENLISA Canine Dopamine Receptor D2 (DRD2) ELISA

Sign In for Pricing
View Details
ALDH1A2 siRNA (Rat)
CRR2986-01 15 nmol

ALDH1A2 siRNA (Rat)

Sign In for Pricing
View Details