Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Hyaluronan and proteoglycan link protein 1 (HAPLN1) . Accession Number: P10915; HAPLN1. Expression Region: 16-354aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.4kda. Target Synonyms: Cartilage-linking protein 1; Cartilage-link protein Proteoglycan link protein CRTL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein.

Accession Number

P10915; HAPLN1

Expression Region

16-354aa

Host

E. coli

Target

Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cartilage-linking protein 1; Cartilage-link protein Proteoglycan link protein CRTL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMHD1 rabbit pAb
ES13050-01 50 µL

SMHD1 rabbit pAb

Sign In for Pricing
View Details
SMHD1 rabbit pAb
ES13050-02 100 µL

SMHD1 rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal ErbB2/Her2 Antibody (HRB2/273) [DyLight 755]
NBP2-48005IR 0.1 mL

Mouse Monoclonal ErbB2/Her2 Antibody (HRB2/273) [DyLight 755]

Sign In for Pricing
View Details
Human Multi-tissue Tissue MicroArray (Normal)
NBP2-78068 5 Slides

Human Multi-tissue Tissue MicroArray (Normal)

Sign In for Pricing
View Details
Ccdc102a ORF Vector (Rat) (pORF)
ORF064453 1.0 µg DNA

Ccdc102a ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Human SERPINF1/PEDF/Serpin F1, N-His
MBS1573949-01 0.1 mg

Recombinant Human SERPINF1/PEDF/Serpin F1, N-His

Sign In for Pricing
View Details