Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Hyaluronan and proteoglycan link protein 1 (HAPLN1) . Accession Number: P10915; HAPLN1. Expression Region: 16-354aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.4kda. Target Synonyms: Cartilage-linking protein 1; Cartilage-link protein Proteoglycan link protein CRTL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein.

Accession Number

P10915; HAPLN1

Expression Region

16-354aa

Host

E. coli

Target

Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cartilage-linking protein 1; Cartilage-link protein Proteoglycan link protein CRTL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DLL3 Antibody (Rovalpituzumab)
F1545-5 5 mg

Anti-DLL3 Antibody (Rovalpituzumab)

Sign In for Pricing
View Details
Rat Monoclonal IL-19 Antibody (350105) [mFluor Violet 500 SE]
FAB29151MFV500 0.1 mL

Rat Monoclonal IL-19 Antibody (350105) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Rabbit Anti-Human IDI1 pAb
PA7432-01 50 μL

Rabbit Anti-Human IDI1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human IDI1 pAb
PA7432-02 100 μL

Rabbit Anti-Human IDI1 pAb

Sign In for Pricing
View Details
Fam83c Mouse shRNA Plasmid (Locus ID 71405)
TL504547 1 Kit

Fam83c Mouse shRNA Plasmid (Locus ID 71405)

Sign In for Pricing
View Details
ABCC9 Protein Vector (Mouse) (pPB-C-His)
PV151162 500 ng

ABCC9 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details