Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Hyaluronan and proteoglycan link protein 1 (HAPLN1) . Accession Number: P10915; HAPLN1. Expression Region: 16-354aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.4kda. Target Synonyms: Cartilage-linking protein 1; Cartilage-link protein Proteoglycan link protein CRTL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein.

Accession Number

P10915; HAPLN1

Expression Region

16-354aa

Host

E. coli

Target

Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-SUMO-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cartilage-linking protein 1; Cartilage-link protein Proteoglycan link protein CRTL1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat 2,3-dinor-TXB2 ELISA Kit
MBS262377-01 48 Well

Goat 2,3-dinor-TXB2 ELISA Kit

Sign In for Pricing
View Details
Goat 2,3-dinor-TXB2 ELISA Kit
MBS262377-02 96 Well

Goat 2,3-dinor-TXB2 ELISA Kit

Sign In for Pricing
View Details
Goat 2,3-dinor-TXB2 ELISA Kit
MBS262377-03 5x 96 Well

Goat 2,3-dinor-TXB2 ELISA Kit

Sign In for Pricing
View Details
Goat 2,3-dinor-TXB2 ELISA Kit
MBS262377-04 10x 96 Well

Goat 2,3-dinor-TXB2 ELISA Kit

Sign In for Pricing
View Details
Cluster of Differentiation (CDl4) Human ELISA Kit
95869 96 Tests

Cluster of Differentiation (CDl4) Human ELISA Kit

Sign In for Pricing
View Details
Stem cell factor (human), (recombinant)
ALX-201-804-0002 2 µg

Stem cell factor (human), (recombinant)

Sign In for Pricing
View Details