Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Anoctamin-1 (ANO1), partial

Recombinant Human Anoctamin-1 (ANO1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: Anoctamin-1 (ANO1) . Accession Number: Q5XXA6; ANO1. Expression Region: 806-892aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.6kda. Target Synonyms: Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Anoctamin-1 (ANO1), partial is a purified Recombinant Protein.

Accession Number

Q5XXA6; ANO1

Expression Region

806-892aa

Host

E. coli

Target

Anoctamin-1 (ANO1)

Conjugation

Unconjugated

Tag

N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Discovered on gastrointestinal stromal tumors protein 1; Oral cancer overexpressed protein 2; Transmembrane protein 16A; Tumor-amplified and overexpressed sequence 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAPGEF3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38506154 3x 1.0 µg DNA

RAPGEF3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
DIMT1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0602708 1.0 µg DNA

DIMT1L sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral human FAM91A1 shRNA (UAS) - Lentiviral human FAM91A1 shRNA (UAS, iRFP) plasmid
GTR15146992 1 Vial

Lentiviral human FAM91A1 shRNA (UAS) - Lentiviral human FAM91A1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Maltononaose (Highly Pure)
B2012941 500 µg

Maltononaose (Highly Pure)

Sign In for Pricing
View Details
Rabbit Anti-HSPD1 Recombinant Antibody (clone 3D8)
ZG-0754J Each

Rabbit Anti-HSPD1 Recombinant Antibody (clone 3D8)

Sign In for Pricing
View Details
MYL2 (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform, MLC-2, MLC-2v, DKFZp779C0562) (MaxLight 750) discontinued
130053-ML750 100 µL

MYL2 (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform, MLC-2, MLC-2v, DKFZp779C0562) (MaxLight 750) discontinued

Sign In for Pricing
View Details