Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial , Active Protein

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor-associated calcium signal transducer 2 (TACSTD2) . Accession Number: P09758; TACSTD2. Expression Region: 27-274aa. Tag Info: C-terminal 10xHis-tagged. Theoretical MW: 30.6kda. Target Synonyms: Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P09758; TACSTD2

Expression Region

27-274aa

Host

Mammalian Cells

Target

Tumor-associated calcium signal transducer 2 (TACSTD2)

Conjugation

Unconjugated

Tag

C-Terminal 10xHis-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR561551 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Recombinant BNIP3 Antibody
RC-16823-01 50 μL

Recombinant BNIP3 Antibody

Sign In for Pricing
View Details
Recombinant BNIP3 Antibody
RC-16823-02 100 µL

Recombinant BNIP3 Antibody

Sign In for Pricing
View Details
Recombinant BNIP3 Antibody
RC-16823-03 1 mL

Recombinant BNIP3 Antibody

Sign In for Pricing
View Details
Recombinant Histone H1.2 Antibody
RC-5086-01 50 μL

Recombinant Histone H1.2 Antibody

Sign In for Pricing
View Details
Recombinant Histone H1.2 Antibody
RC-5086-02 100 µL

Recombinant Histone H1.2 Antibody

Sign In for Pricing
View Details